CDH23 SNPs: Difference between revisions
Tomemerald (talk | contribs) (New page: == CDH23 SNPs == CDH23 (cadherin 23) on 10q22.1 is one of the better understood genes of the Usher disease complex. These genes generally encode structural proteins utilized in both heari...) |
Tomemerald (talk | contribs) |
||
Line 14: | Line 14: | ||
Orthologs of CDH32 are available from 42 vertebrates in the region surrounding L1122V. Observe that while leucine is sometimes found at this position in other species, it is concentrated solely in early diverging vertebrates. In all 33 species of tetrapods (where sound is conducted primarily through air), the value here is exclusively valine. Note in particular the four other species of great apes have valine. From this perspective, L1122V may reflect retention of the ancestral value in one allele, rather than result from mutation. In other words, L1122 could be viewed as a mutation fixed for better or worse in all other human populatons. | Orthologs of CDH32 are available from 42 vertebrates in the region surrounding L1122V. Observe that while leucine is sometimes found at this position in other species, it is concentrated solely in early diverging vertebrates. In all 33 species of tetrapods (where sound is conducted primarily through air), the value here is exclusively valine. Note in particular the four other species of great apes have valine. From this perspective, L1122V may reflect retention of the ancestral value in one allele, rather than result from mutation. In other words, L1122 could be viewed as a mutation fixed for better or worse in all other human populatons. | ||
<----------cad10----------><------interdomain--------><---cad11---> | |||
................................................^. | |||
CDH23_homSap DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSI<font color="red">L</font>Q | CDH23_homSap DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSI<font color="red">L</font>Q | ||
CDH23_panTro DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSI<font color="blue">V</font>Q | CDH23_panTro DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSI<font color="blue">V</font>Q | ||
Line 58: | Line 58: | ||
CDH23_calMil DNGPAGSRRTGTATVYIRVLDVNDNRPIFLQNTYEASVPENITMSTSI<font color="red">L</font>Q | CDH23_calMil DNGPAGSRRTGTATVYIRVLDVNDNRPIFLQNTYEASVPENITMSTSI<font color="red">L</font>Q | ||
CDH23_petMar DHGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYZVSVPDNVTRGAIF<font color="red">L</font>Q | CDH23_petMar DHGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYZVSVPDNVTRGAIF<font color="red">L</font>Q | ||
................................................^. | |||
CDH23_homSap DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQ | CDH23_homSap DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQ | ||
CDH23_panTro ................................................V. | CDH23_panTro ................................................V. | ||
Line 102: | Line 102: | ||
CDH23_petMar .H..A.S.R...T.LD.L.........L..EG..ZV...DNVTR.AIF.. | CDH23_petMar .H..A.S.R...T.LD.L.........L..EG..ZV...DNVTR.AIF.. | ||
Consensus .n..a...r...a.v..t.l.......i..qs..#as!p#.!p.g.siv. | Consensus .n..a...r...a.v..t.l.......i..qs..#as!p#.!p.g.siv. | ||
................................................^. | |||
=== Pseudogene issues === | === Pseudogene issues === | ||
(to be continued shortly) | (to be continued shortly) |
Revision as of 13:31, 10 August 2009
CDH23 SNPs
CDH23 (cadherin 23) on 10q22.1 is one of the better understood genes of the Usher disease complex. These genes generally encode structural proteins utilized in both hearing and visual systems -- and so at the mutational level by effects on both. Stop codons within CDH23 cause both deafness and blindness (USH1D) whereas missense alleles can affect hearing only (DFNB12). Both conditions are autosomal recessive. However one bad copy of CDH23 in conjunction with one bad allele of PCDH15 (protocadherin 15) on 10q21.1 (17 million bp over, not tandem) can give rise to the digenic disease USH1H. That has a simple physical explanation in defective heteroligomeric binding of the two terminal domains where the respective cSNPs occur.
Many Usher genes function both transiently during development of cochlea and retina and permenantly in adult structures. These functions may localize to multiple sites within each organ, for example ribbon synapses and stereocilia. CDH23 like many of these proteins has different binding partners to its cytoplasimic and extracellular domains as well as a transmembrane region. Other unrelated cell types elsewhere in the body may use these gene products though mutant alleles to date first manifest in hearing and vision. The role of CDH23 in hair tip links has recently been disentangled from its transient but critical role in hair cell development.
However some coding variants of CDH23 are simply near-normal (or even adaptive) polymorphic variants not giving rise to problems during the carrier's lifespan, though subtle subclinical effects on age related (or noise-induced) hearing loss or night vision acuity might still occur. In the past, such variations would be occasionally be detected within geneologies of affected indiviuals but not track with their disease; today, coding SNPs are far more likely to emerge -- and in far greater numbers -- simply in the course of genomic screening. That trend will only accerate with the advent of rapid screening platforms such as Nimblegen that can affordably screen the entire human proteome.
Note these myriad new cSNPs needing interpretation will come with accurate population frequencies further stratified by ethnic group distribution. That can be viewed as 'close-up' comparative genomics that complements the longer view of reduced alphabet afforded currently by CDH23 orthologs in 50-odd vertebrate genome phylogenetic tree. These considerations, along with accurate 3D models of both the cadherin module affected and protein binding partner, greatly help in interpreting disease implications of particular observed SNPs (for example E737V), yet uncertainty will remain in many instances.
Here a newly observed cSNP in a Kalahari Bushmen, heterozygous L1122V in exon 26, lies fall just before the boundary of the 11th of 27 cadherin ectodomains of the 3354 residue, 67 exon protein. This would appear unremarkable except for the observation that valine is ancestral mammalian value here and conserved over vast phylogenetic time.
Comparative genomics
Orthologs of CDH32 are available from 42 vertebrates in the region surrounding L1122V. Observe that while leucine is sometimes found at this position in other species, it is concentrated solely in early diverging vertebrates. In all 33 species of tetrapods (where sound is conducted primarily through air), the value here is exclusively valine. Note in particular the four other species of great apes have valine. From this perspective, L1122V may reflect retention of the ancestral value in one allele, rather than result from mutation. In other words, L1122 could be viewed as a mutation fixed for better or worse in all other human populatons.
<----------cad10----------><------interdomain--------><---cad11---> ................................................^. CDH23_homSap DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQ CDH23_panTro DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_gorGor dNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_ponAbe DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASIPEDIPEGHSIVQ CDH23_nomLeu DNGPVGKRHTGTATVFITVLDVNDNRPIFLQSSYEASIPEDIPEGHSIVQ CDH23_rheMac DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_calJac DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_tarSyr DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_micMur DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_musMus DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_ratNor DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_cavPor DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_speTri DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_oryCun DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_ochPri DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIVEGHSIVQ CDH23_bosTau DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVSEDIPEGHSIVQ CDH23_canFam DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_felCat DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_pteVam DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_turTru DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_susScr DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_equCab DNGPVGKRRTGTATVFITVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_eriEur dNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_loxAfr DNGPVGKRRTGTTTVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_proCap DNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASIPEDIPEGHSIVQ CDH23_echTel dNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQ CDH23_choHof dNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGRSIVQ CDH23_monDom DNGPVGKRRTGTATIYVTVLDVNDNRPIFLQSSYEASVPEDIPEGSSIVQ CDH23_macEug DNGPVGKRRTGTATVYVTVLDVNDNRPIFLHSSYEASISEDIPEGSSIVQ CDH23_ornAna DNGPSGKRRTGTATVYVTVLDVNDNRPIFLQSSYEASVPEDIPEASSIVQ CDH23_galGal DNGPTGNRRTGTATVYVTVLDVNDNRPIFLQSSYEASVPEDIPAASSIVQ CDH23_taeGut DNGPSGNRRTGTATVYVTVLDVNDNRPIFLQSSYEVSVPEDIPAASSIVQ CDH23_anoCar DNGPTGKRRTGTATVHVTVLDVNDNRPYFLQSSYEATVPEDIPDYSSIVQ CDH23_xenTro DNGPAGNRKTGTATVSVTVLDINDNKPIFLKSSYEASVPENVPFSSSIVQ CDH23_oryLat DNGPAGSRRTGTATVFVEVLDVNDNRPIFLQNSYETSVLETVPQGTSILQ CDH23_takRub DNGPAGSRRTGTATVFVEVQDVNDNRPIFLQNSYETGILESVPQGTSILQ CDH23_danRer DNGPAGGRRTGTATVYVEVLDVNDNRPIFLQNSYETSVLENIPRGTSILQ CDH23_gasAcu DNGPAGSRRTGTATVFVEVQDVNDNRPIFLQNSYETSILESVPQRTSILK CDH23_tetNig DNGPAGSRRTGTATVFVEVQDVNDNRPIFLQNSYETSVLESVPQGTSILQ CDH23_ictPun DNGPAGDRKTGTATVYVEVLDVNDNRPIFLQNSYETTVLENVPRGSSVLQ CDH23_calMil DNGPAGSRRTGTATVYIRVLDVNDNRPIFLQNTYEASVPENITMSTSILQ CDH23_petMar DHGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYZVSVPDNVTRGAIFLQ ................................................^. CDH23_homSap DNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQ CDH23_panTro ................................................V. CDH23_gorGor ................................................V. CDH23_rheMac ................................................V. CDH23_calJac ................................................V. CDH23_pteVam ................................................V. CDH23_ponAbe .....................................I..........V. CDH23_nomLeu ................I....................I..........V. CDH23_tarSyr ........R.......................................V. CDH23_micMur ........R.......................................V. CDH23_musMus ........R.......................................V. CDH23_ratNor ........R.......................................V. CDH23_cavPor ........R.......................................V. CDH23_speTri ........R.......................................V. CDH23_oryCun ........R.......................................V. CDH23_canFam ........R.......................................V. CDH23_felCat ........R.......................................V. CDH23_turTru ........R.......................................V. CDH23_susScr ........R.......................................V. CDH23_echTel ........R.......................................V. CDH23_eriEur ........R.......................................V. CDH23_proCap ........R............................I..........V. CDH23_equCab ........R.......I...............................V. CDH23_loxAfr ........R...T...................................V. CDH23_choHof ........R....................................R..V. CDH23_bosTau ........R.............................S.........V. CDH23_ochPri ..........................................V.....V. CDH23_monDom ........R.....IY.............................S..V. CDH23_macEug ........R......Y..............H......IS......S..V. CDH23_ornAna ....S...R......Y............................AS..V. CDH23_galGal ....T.N.R......Y...........................AAS..V. CDH23_taeGut ....S.N.R......Y...................V.......AAS..V. CDH23_anoCar ....T...R......H...........Y........T......DYS..V. CDH23_xenTro ....A.N.K......S.....I...K....K.........NV.FSS..V. CDH23_oryLat ....A.S.R........E.............N...T..L.TV.Q.T.... CDH23_takRub ....A.S.R........E.Q...........N...TGIL.SV.Q.T.... CDH23_tetNig ....A.S.R........E.Q...........N...T..L.SV.Q.T.... CDH23_gasAcu ....A.S.R........E.Q...........N...T.IL.SV.QRT...K CDH23_danRer ....A.G.R......Y.E.............N...T..L.N..R.T.... CDH23_ictPun ....A.D.K......Y.E.............N...TT.L.NV.R.S.V.. CDH23_calMil ....A.S.R......YIR.............NT.......N.TMST.... CDH23_petMar .H..A.S.R...T.LD.L.........L..EG..ZV...DNVTR.AIF.. Consensus .n..a...r...a.v..t.l.......i..qs..#as!p#.!p.g.siv. ................................................^.
Pseudogene issues
(to be continued shortly)